This is in response to a few issues with the full length proteins not being completely viewable. This information will also be attached with a word document.

Peptide Synthesis, 20mg at >70%: OVOC8995: 1 EACH

MNAGSKHAFVMKIYRCKSQLAFLDTVILSVPTWGSMDEEVHGKEYLGLST

PCCVGTCVVECMHGNVPVP

Peptide Synthesis, 20mg at >70%: OVOC12838: 1 EACH

MLPGFLEYSLAGKALEKKIWNLEVVDIRFFAEDKHSTVDDVPYGGGAGMI

MRPDVIGSAVDSVFSAHKNTRFIYMTPSGTKFNQ

Both of these full length peptides are not to be conjugated. The three small peptides are the only products needing conjugated.

Furthermore, the least purity expected is 70% but the higher the purity the better. This is a onetime shipment and will not be an ongoing service or contain any sort of period of performance. Additionally, the soonest the peptides can be completed and shipped the better. We understand this is a significant undertaking and it may take a few weeks but we would like them by 5/31/2014. Please provide a quote even if you believe the end of May is unobtainable.

Resonses will be accepted until 5/1/2014 at 12:00 PM MST